Structure of PDB 2i3p Chain A Binding Site BS02

Receptor Information
>2i3p Chain A (length=152) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NTKYNKEFLLYLAGFVDGDGSIIAQIRPNQSYKFKHQLSLTFQVTQKTQR
RWFLDKLVDEIGVGYVRDRGSVSDYILSEIKPLHNFLTQLQPFLKLKQKQ
ANLVLKIIEQLPSAKESPDKFLEVCTWVDQIAALNDSKTRKTTSETVRAV
LD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2i3p Homing endonuclease I-CreI derivatives with novel DNA target specificities.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		S32 Y33 K34 Q38 R68 R70 E80 I81 K116 K139
Binding residue
(residue number reindexed from 1)		S31 Y32 K33 Q37 R67 R69 E79 I80 K115 K138
Enzymatic activity
Catalytic site (original residue number in PDB) G19 D20
Catalytic site (residue number reindexed from 1) G18 D19
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
GO:0042802 identical protein binding
GO:0046872 metal ion binding
Biological Process
GO:0006314 intron homing
Cellular Component
GO:0009507 chloroplast

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2i3p, PDBe:2i3p, PDBj:2i3p
PDBsum2i3p
PubMed16971456
UniProtP05725|DNE1_CHLRE DNA endonuclease I-CreI

[Back to BioLiP]