Structure of PDB 2i32 Chain A Binding Site BS02

Receptor Information
>2i32 Chain A (length=154) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MAKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSAES
EEYDQVLDSVLVGPVPAGRHMFVFQADAPNPGLIPDADAVGVTVVLITCT
YRGQEFIRVGYYVNNEYTETELRENPPVKPDFSKLQRNILASNPRVTRFH
INWE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2i32 Structure of a human ASF1a-HIRA complex and insights into specificity of histone chaperone complex assembly.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		Y19 S133
Binding residue
(residue number reindexed from 1)		Y19 S133
Enzymatic activity
Catalytic site (original residue number in PDB) I107 E116 V146
Catalytic site (residue number reindexed from 1) I107 E116 V146
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006325 chromatin organization
Cellular Component
GO:0005634 nucleus

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2i32, PDBe:2i32, PDBj:2i32
PDBsum2i32
PubMed16980972
UniProtQ9Y294|ASF1A_HUMAN Histone chaperone ASF1A (Gene Name=ASF1A)

[Back to BioLiP]