Structure of PDB 2hdc Chain A Binding Site BS02

Receptor Information
>2hdc Chain A (length=97) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VKPPYSYIALITMAILQSPQKKLTLSGICEFISNRFPYYREKFPAWQNSI
RHNLSLNDCFVKIPREPGNPGKGNYWTLDPQSEDMFDNGSFLRRRKR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2hdc Dynamic DNA contacts observed in the NMR structure of winged helix protein-DNA complex.
ResolutionN/A
Binding residue
(original residue number in PDB)		L26 R52 H53 K63 I64 P65 R66 N70 G72 K73 N75 W77 R95 K97 R98
Binding residue
(residue number reindexed from 1)		L25 R51 H52 K62 I63 P64 R65 N69 G71 K72 N74 W76 R94 K96 R97
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0000977 RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0001227 DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0003677 DNA binding
GO:0003690 double-stranded DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
GO:1990837 sequence-specific double-stranded DNA binding
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0001701 in utero embryonic development
GO:0001829 trophectodermal cell differentiation
GO:0001892 embryonic placenta development
GO:0006355 regulation of DNA-templated transcription
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:1990830 cellular response to leukemia inhibitory factor
Cellular Component
GO:0000785 chromatin
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2hdc, PDBe:2hdc, PDBj:2hdc
PDBsum2hdc
PubMed10369754
UniProtQ63245|FOXD3_RAT Forkhead box protein D3 (Fragment) (Gene Name=Foxd3)

[Back to BioLiP]