Structure of PDB 2hax Chain A Binding Site BS02

Receptor Information
>2hax Chain A (length=66) Species: 1394 ([Bacillus] caldolyticus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MQRGKVKWFNNEKGYGFIEVEGGSDVFVHFTAIQGEGFKTLEEGQEVSFE
IVQGNRGPQAANVVKL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2hax Common mode of DNA binding to cold shock domains. Crystal structure of hexathymidine bound to the domain-swapped form of a major cold shock protein from Bacillus caldolyticus.
Resolution1.29 Å
Binding residue
(original residue number in PDB)		F38 K39 R56 P58 Q59
Binding residue
(residue number reindexed from 1)		F38 K39 R56 P58 Q59
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003677 DNA binding
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:2hax, PDBe:2hax, PDBj:2hax
PDBsum2hax
PubMed17266726
UniProtP41016|CSPB_BACCL Cold shock protein CspB (Gene Name=cspB)

[Back to BioLiP]