Structure of PDB 2h8r Chain A Binding Site BS02

Receptor Information
>2h8r Chain A (length=176) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SILKELQALNTEEAAEQRAEVDRMLSEDPWRAAKMIKGYMQQHNIPQREV
VDVTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREILRQFNQTVMR
RNRFKWGPASQQILYQAYDRQKNPSKEEREALVEECNRAECLQRGVSPSK
AHGLGSNLVTEVRVYNWFANRRKEEA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2h8r Structural basis of disease-causing mutations in hepatocyte nuclear factor 1beta.
Resolution3.2 Å
Binding residue
(original residue number in PDB)
N146 S148 H149 P159 K161 K164 F236 K237 W238 N302 K305
Binding residue
(residue number reindexed from 1)
N57 S59 H60 P70 K72 K75 F104 K105 W106 N170 K173
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0001889 liver development
GO:0006357 regulation of transcription by RNA polymerase II
GO:0030073 insulin secretion
GO:0031016 pancreas development
GO:0045893 positive regulation of DNA-templated transcription
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:2h8r, PDBe:2h8r, PDBj:2h8r
PDBsum2h8r
PubMed17924661
UniProtP35680|HNF1B_HUMAN Hepatocyte nuclear factor 1-beta (Gene Name=HNF1B)

[Back to BioLiP]