Structure of PDB 2h3c Chain A Binding Site BS02

Receptor Information
>2h3c Chain A (length=72) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKQRITVTVDSDSYQLLKAYDVNISGLVSTTMQNEARRLRAERWKVENQE
GMVEVARFIEMNGSFADENKDW
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2h3c Structural Basis for Nucleic Acid and Toxin Recognition of the Bacterial Antitoxin CcdA
ResolutionN/A
Binding residue
(original residue number in PDB)		K2 R4 Y14 N23 S25
Binding residue
(residue number reindexed from 1)		K2 R4 Y14 N23 S25
Binding affinityPDBbind-CN: Kd=88.5uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0097351 toxin sequestering activity
Biological Process
GO:0032984 protein-containing complex disassembly
GO:0045892 negative regulation of DNA-templated transcription
Cellular Component
GO:0017053 transcription repressor complex
GO:0110001 toxin-antitoxin complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2h3c, PDBe:2h3c, PDBj:2h3c
PDBsum2h3c
PubMed17007877
UniProtP62552|CCDA_ECOLI Antitoxin CcdA (Gene Name=ccdA)

[Back to BioLiP]