Structure of PDB 2gm4 Chain A Binding Site BS02

Receptor Information

>2gm4 Chain A (length=179) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MALFGYARVSTSQQSLDIQVRALKDAGVKANRIFTDKASDRKGLDLLRMK
VKEGDVILVKKLDRLGRDTADMIQLIKEFDAQGVSIRFIDDSIDTSSAMG
RMVVTILSAVAQAERQRILQRTNEGRQEAMAKGVVFGRKRKIDRDAVLNM
WQQGLGASHISKTMNIARSTVYKVINESN

Ligand information

>2gm4 Chain Z (length=3) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aaa

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2gm4 Implications of structures of synaptic tetramers of gamma delta resolvase for the mechanism of recombination.
Resolution	3.5 Å
Binding residue (original residue number in PDB)	S10 R68 R130
Binding residue (residue number reindexed from 1)	S10 R64 R126

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000150	DNA strand exchange activity
GO:0003677	DNA binding

	Biological Process
GO:0006310	DNA recombination
GO:0015074	DNA integration

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:2gm4, PDBe:2gm4, PDBj:2gm4
PDBsum	2gm4
PubMed	16807292
UniProt	P03012\|TNR1_ECOLI Transposon gamma-delta resolvase (Gene Name=tnpR)

[Back to BioLiP]