Structure of PDB 2glo Chain A Binding Site BS02

Receptor Information
>2glo Chain A (length=59) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSRRIFTPHFKLQVLESYRNDNDCKGNQRATARKYNIHRRQIQKWLQCES
NLRSSVANN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2glo DNA recognition by the brinker repressor - an extreme case of coupling between binding and folding
ResolutionN/A
Binding residue
(original residue number in PDB)		S44 R45 F48 K53 H80 R82 Q83 W87
Binding residue
(residue number reindexed from 1)		S2 R3 F6 K11 H38 R40 Q41 W45
Binding affinityPDBbind-CN: Kd=30nM
Enzymatic activity
Enzyme Commision number ?
External links