Structure of PDB 2gli Chain A Binding Site BS02

Receptor Information
>2gli Chain A (length=155) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ETDCRWDGCSQEFDSQEQLVHHINSEHIHGERKEFVCHWGGCSRELRPFK
AQYMLVVHMRRHTGEKPHKCTFEGCRKSYSRLENLKTHLRSHTGEKPYMC
EHEGCSKAFSNASDRAKHQNRTHSNEKPYVCKLPGCTKRYTDPSSLRKHV
KTVHG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2gli Crystal structure of a five-finger GLI-DNA complex: new perspectives on zinc fingers.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		R146 F151 K152 H160 Y181 R183 H220 T224 Y242 D244 S247 K250
Binding residue
(residue number reindexed from 1)		R44 F49 K50 H58 Y79 R81 H118 T122 Y140 D142 S145 K148
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000977 RNA polymerase II transcription regulatory region sequence-specific DNA binding
Biological Process
GO:0006357 regulation of transcription by RNA polymerase II
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2gli, PDBe:2gli, PDBj:2gli
PDBsum2gli
PubMed8378770
UniProtP08151|GLI1_HUMAN Zinc finger protein GLI1 (Gene Name=GLI1)

[Back to BioLiP]