Structure of PDB 2gig Chain A Binding Site BS02

Receptor Information
>2gig Chain A (length=249) Species: 727 (Haemophilus influenzae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SFIKPIYQDINSILIGQKVKRPHAAGEPFEKLVYKFLKENLSDLTFKQYE
YLNDLFMKNPAIIGHEARYKLFNSPTLLFLLSRGKAATENWSIENLFEEK
QNDTADILLVKDQFYELLDVKTRNISKSAFAPNIISAYKLAQTCAKMIDN
KEFDLFDINYLEVDWELNGEDLVCVSTSFAELFKSEPSELYINWAAAMQI
QFHVRDLDQGFNGTREEWAKSYLKHFVTQAEQRAISMIDKFVKPFKKYI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2gig Alteration of Sequence Specificity of the Type II Restriction Endonuclease HincII through an Indirect Readout Mechanism.
Resolution1.83 Å
Binding residue
(original residue number in PDB)		Q109 N110 D111 D114 D127 K129 T130 R131 S136 A137 F138 A139 P140 N141 S144 K147 A205 M206 Q207
Binding residue
(residue number reindexed from 1)		Q101 N102 D103 D106 D119 K121 T122 R123 S128 A129 F130 A131 P132 N133 S136 K139 A197 M198 Q199
Binding affinityPDBbind-CN: Kd=1.03nM
Enzymatic activity
Enzyme Commision number 3.1.21.4: type II site-specific deoxyribonuclease.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004519 endonuclease activity
GO:0009036 type II site-specific deoxyribonuclease activity
Biological Process
GO:0009307 DNA restriction-modification system

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2gig, PDBe:2gig, PDBj:2gig
PDBsum2gig
PubMed16675462
UniProtP17743|T2C2_HAEIF Type II restriction enzyme HincII (Gene Name=hincIIR)

[Back to BioLiP]