Structure of PDB 2g8h Chain A Binding Site BS02

Receptor Information
>2g8h Chain A (length=136) Species: 86665 (Halalkalibacterium halodurans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEF
LAIVHGLRYLKERNSRKPIYSDSQTAIKWVKDKKAKSTLVRNEETALIWK
LVDEAEEWLNTHTYETPILKWQTDKWGEIKANYGRK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2g8h Stepwise analyses of metal ions in RNase H catalysis from substrate destabilization to product release.
Resolution1.85 Å
Binding residue
(original residue number in PDB)		N77 P78 T104 N105 N106 Q134 K138 W139 S147 T148
Binding residue
(residue number reindexed from 1)		N17 P18 T44 N45 N46 Q74 K78 W79 S87 T88
Enzymatic activity
Enzyme Commision number 3.1.26.4: ribonuclease H.
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0004523 RNA-DNA hybrid ribonuclease activity

View graph for
Molecular Function
External links
PDB RCSB:2g8h, PDBe:2g8h, PDBj:2g8h
PDBsum2g8h
PubMed16601679
UniProtQ9KEI9|RNH1_HALH5 Ribonuclease H (Gene Name=rnhA)

[Back to BioLiP]