Structure of PDB 2g30 Chain A Binding Site BS02

Receptor Information
>2g30 Chain A (length=233) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GGYVAPKAVWLPAVKAKGLEISGTFTHRQGHIYMEMNFTNKALQHMTDFA
IQFNKNSFGVIPSTPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQ
VAVKNNIDVFYFSCLIPLNVLFVEDGKMERQVFLATWKDIPNENELQFQI
KECHLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELR
IQPGNPNYTLSLKCRAPEVSQYIYQVYDSILKN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2g30 Molecular Switches Involving the AP-2 beta2 Appendage Regulate Endocytic Cargo Selection and Clathrin Coat Assembly
Resolution1.6 Å
Binding residue
(original residue number in PDB)		Q756 N758 Y815
Binding residue
(residue number reindexed from 1)		Q52 N54 Y111
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006886 intracellular protein transport
GO:0016192 vesicle-mediated transport
Cellular Component
GO:0030117 membrane coat
GO:0030131 clathrin adaptor complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2g30, PDBe:2g30, PDBj:2g30
PDBsum2g30
PubMed16516836
UniProtP63010|AP2B1_HUMAN AP-2 complex subunit beta (Gene Name=AP2B1)

[Back to BioLiP]