Structure of PDB 2ff0 Chain A Binding Site BS02

Receptor Information
>2ff0 Chain A (length=102) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKHYTCTESQSCKIDK
TQRKRCPFCRFQKCLTVGMRLEAVRADRMRGGRNKFGPMYKRDRALKQQK
KA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2ff0 Sequence-specific deoxyribonucleic Acid (DNA) recognition by steroidogenic factor 1: a helix at the carboxy terminus of the DNA binding domain is necessary for complex stability.
ResolutionN/A
Binding residue
(original residue number in PDB)		E31 S32 F36 R39 R62 K63 R69 M88 R89 G90 R92 P97 K100
Binding residue
(residue number reindexed from 1)		E22 S23 F27 R30 R53 K54 R60 M79 R80 G81 R83 P88 K91
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0004879 nuclear receptor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2ff0, PDBe:2ff0, PDBj:2ff0
PDBsum2ff0
PubMed16339274
UniProtP33242|STF1_MOUSE Steroidogenic factor 1 (Gene Name=Nr5a1)

[Back to BioLiP]