Structure of PDB 2evg Chain A Binding Site BS02

Receptor Information
>2evg Chain A (length=290) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VILTQLNEDGTTSNYFDKRKLKIAPRSTLQFKVGPPFELVRDYCPVVESH
TGRTLDLRIIPRIDRGFDHIDEEWVGYKRNYFTLVSTFETANCDLDTFLK
SSFDLLVGRLRVQYFAIKIKAKNDDDDTEINLVQHTAKRDKGPQFCPSVC
PLVPSPLPKHQTIREASNVRNITKMKKYDSTFYLHRDHVNYEEYGVDSLL
FSYPEDSIQKVARYERVQFASSISVKKPSQQNKHFSLHVILGAVVDPDGI
PYDELALKNGSKGMFVYLQEMKTPPLIIRGRSPSNYASSQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2evg Principles of Protein-DNA Recognition Revealed in the Structural Analysis of Ndt80-MSE DNA Complexes.
Resolution1.55 Å
Binding residue
(original residue number in PDB)		K50 K54 P57 R58 R97 R111 N112 Y113 A175 K176 R177 N206 R254 Y331 S333
Binding residue
(residue number reindexed from 1)		K18 K22 P25 R26 R65 R79 N80 Y81 A137 K138 R139 N168 R216 Y286 S288
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2evg, PDBe:2evg, PDBj:2evg
PDBsum2evg
PubMed16531239
UniProtP38830|NDT80_YEAST Meiosis-specific transcription factor NDT80 (Gene Name=NDT80)

[Back to BioLiP]