Structure of PDB 2efw Chain A Binding Site BS02

Receptor Information
>2efw Chain A (length=115) Species: 1423 (Bacillus subtilis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
STGFLVKQRAFLKLYMITMTEQERLYGLKLLEVLRSEFKEIGFKPNHTEV
YRSLHELLDDGILKQIKVKKEGAKLQEVVLYQFKDYEAAKLYKKQLKVEL
DRSKKLIEKALSDNF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2efw An asymmetric structure of the Bacillus subtilis replication terminator protein in complex with DNA
Resolution2.5 Å
Binding residue
(original residue number in PDB)		T9 Y33 L35 H54 T55 Y58 H62 K77 Q83
Binding residue
(residue number reindexed from 1)		T2 Y26 L28 H47 T48 Y51 H55 K70 Q76
Binding affinityPDBbind-CN: Kd=40pM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006274 DNA replication termination

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2efw, PDBe:2efw, PDBj:2efw
PDBsum2efw
PubMed17521668
UniProtP0CI76|RTP_BACSU Replication termination protein (Gene Name=rtp)

[Back to BioLiP]