Structure of PDB 2e7e Chain A Binding Site BS02

Receptor Information
>2e7e Chain A (length=212) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QDLSEALKEATKEVHIRAENSEFMRNFQKGQVSREGFKLVMASLYHIYTA
LEEEIERNKQNPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEAIPYTPA
TQHYVKRLHEVGGTHPELLVAHAYTRYLGDLSGGQVLKKIAQKAMALPSS
GEGLAFFTFPSIDNPTKFKQLYRARMNTLEMTPEVKHRVTEEAKTAFLLN
IELFEELQALLT
Ligand information
Ligand IDHEM
InChIInChI=1S/C34H34N4O4.Fe/c1-7-21-17(3)25-13-26-19(5)23(9-11-33(39)40)31(37-26)16-32-24(10-12-34(41)42)20(6)28(38-32)15-30-22(8-2)18(4)27(36-30)14-29(21)35-25;/h7-8,13-16H,1-2,9-12H2,3-6H3,(H4,35,36,37,38,39,40,41,42);/q;+2/p-2/b25-13-,26-13-,27-14-,28-15-,29-14-,30-15-,31-16-,32-16-;
InChIKeyKABFMIBPWCXCRK-RGGAHWMASA-L
SMILES
SoftwareSMILES
OpenEye OEToolkits 1.7.6Cc1c2n3c(c1CCC(=O)O)C=C4C(=C(C5=[N]4[Fe]36[N]7=C(C=C8N6C(=C5)C(=C8C)C=C)C(=C(C7=C2)C)C=C)C)CCC(=O)O
CACTVS 3.385CC1=C(CCC(O)=O)C2=Cc3n4[Fe]5|6|N2=C1C=c7n5c(=CC8=N|6C(=Cc4c(C)c3CCC(O)=O)C(=C8C=C)C)c(C)c7C=C
ACDLabs 12.01C=1c3c(c(c4C=C5C(=C(C=6C=C7C(=C(C8=CC=2C(=C(C=1N=2[Fe](n34)(N5=6)N78)CCC(=O)O)C)\C=C)C)\C=C)C)C)CCC(=O)O
FormulaC34 H32 Fe N4 O4
NamePROTOPORPHYRIN IX CONTAINING FE;
HEME
ChEMBL
DrugBankDB18267
ZINC
PDB chain2e7e Chain A Residue 300 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2e7e Alternative cyanide-binding modes to the haem iron in haem oxygenase
Resolution1.85 Å
Binding residue
(original residue number in PDB)		K18 H25 E29 M34 Y134 T135 G139 S142 G143 L147 K179 R183 F207 N210
Binding residue
(residue number reindexed from 1)		K8 H15 E19 M24 Y124 T125 G129 S132 G133 L137 K169 R173 F197 N200
Annotation score4
Enzymatic activity
Catalytic site (original residue number in PDB) N30 Y58 T135 R136 G139 D140 G144
Catalytic site (residue number reindexed from 1) N20 Y48 T125 R126 G129 D130 G134
Enzyme Commision number 1.14.14.18: heme oxygenase (biliverdin-producing).
Gene Ontology
Molecular Function
GO:0004392 heme oxygenase (decyclizing) activity
GO:0004630 phospholipase D activity
GO:0005198 structural molecule activity
GO:0005515 protein binding
GO:0016491 oxidoreductase activity
GO:0019899 enzyme binding
GO:0020037 heme binding
GO:0042802 identical protein binding
GO:0042803 protein homodimerization activity
GO:0046872 metal ion binding
GO:0052869 arachidonate omega-hydroxylase activity
Biological Process
GO:0001525 angiogenesis
GO:0001666 response to hypoxia
GO:0002246 wound healing involved in inflammatory response
GO:0006357 regulation of transcription by RNA polymerase II
GO:0006644 phospholipid metabolic process
GO:0006788 heme oxidation
GO:0006879 intracellular iron ion homeostasis
GO:0006915 apoptotic process
GO:0006979 response to oxidative stress
GO:0007264 small GTPase-mediated signal transduction
GO:0008217 regulation of blood pressure
GO:0008285 negative regulation of cell population proliferation
GO:0008630 intrinsic apoptotic signaling pathway in response to DNA damage
GO:0009410 response to xenobiotic stimulus
GO:0010656 negative regulation of muscle cell apoptotic process
GO:0016236 macroautophagy
GO:0016239 positive regulation of macroautophagy
GO:0016242 negative regulation of macroautophagy
GO:0031670 cellular response to nutrient
GO:0032764 negative regulation of mast cell cytokine production
GO:0034101 erythrocyte homeostasis
GO:0034605 cellular response to heat
GO:0035094 response to nicotine
GO:0035556 intracellular signal transduction
GO:0042167 heme catabolic process
GO:0042168 heme metabolic process
GO:0042542 response to hydrogen peroxide
GO:0043305 negative regulation of mast cell degranulation
GO:0043524 negative regulation of neuron apoptotic process
GO:0043627 response to estrogen
GO:0045766 positive regulation of angiogenesis
GO:0048661 positive regulation of smooth muscle cell proliferation
GO:0048662 negative regulation of smooth muscle cell proliferation
GO:0060586 multicellular organismal-level iron ion homeostasis
GO:0071243 cellular response to arsenic-containing substance
GO:0071276 cellular response to cadmium ion
GO:0072719 cellular response to cisplatin
GO:0090050 positive regulation of cell migration involved in sprouting angiogenesis
GO:0097421 liver regeneration
GO:0110076 negative regulation of ferroptosis
GO:1902042 negative regulation of extrinsic apoptotic signaling pathway via death domain receptors
GO:1903589 positive regulation of blood vessel endothelial cell proliferation involved in sprouting angiogenesis
GO:1904019 epithelial cell apoptotic process
GO:1904036 negative regulation of epithelial cell apoptotic process
GO:1904037 positive regulation of epithelial cell apoptotic process
GO:1904550 response to arachidonate
GO:1904681 response to 3-methylcholanthrene
GO:1904706 negative regulation of vascular associated smooth muscle cell proliferation
Cellular Component
GO:0005634 nucleus
GO:0005783 endoplasmic reticulum
GO:0005789 endoplasmic reticulum membrane
GO:0005829 cytosol
GO:0005901 caveola
GO:0016020 membrane
GO:0048471 perinuclear region of cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2e7e, PDBe:2e7e, PDBj:2e7e
PDBsum2e7e
PubMed17554165
UniProtP06762|HMOX1_RAT Heme oxygenase 1 (Gene Name=Hmox1)

[Back to BioLiP]