Structure of PDB 2dvr Chain A Binding Site BS02

Receptor Information
>2dvr Chain A (length=114) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GRVTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMD
MGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQTLEKI
FLQKVASMPQEEQE
Ligand information
>2dvr Chain Q (length=10) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GGKGLGKGGA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2dvr Structural Basis for Acetylated Histone H4 Recognition by the Human BRD2 Bromodomain.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		Y87 I88 K91 P92 T93
Binding residue
(residue number reindexed from 1)		Y81 I82 K85 P86 T87
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2dvr, PDBe:2dvr, PDBj:2dvr
PDBsum2dvr
PubMed20048151
UniProtP25440|BRD2_HUMAN Bromodomain-containing protein 2 (Gene Name=BRD2)

[Back to BioLiP]