Structure of PDB 2dvq Chain A Binding Site BS02

Receptor Information
>2dvq Chain A (length=114) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GRVTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMD
MGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQTLEKI
FLQKVASMPQEEQE
Ligand information
>2dvq Chain Q (length=15) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SGRGKGGKGLGKGGA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2dvq Structural Basis for Acetylated Histone H4 Recognition by the Human BRD2 Bromodomain.
Resolution2.04 Å
Binding residue
(original residue number in PDB)		Y153 I154 K157 P158 T159 Q167
Binding residue
(residue number reindexed from 1)		Y81 I82 K85 P86 T87 Q95
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2dvq, PDBe:2dvq, PDBj:2dvq
PDBsum2dvq
PubMed20048151
UniProtP25440|BRD2_HUMAN Bromodomain-containing protein 2 (Gene Name=BRD2)

[Back to BioLiP]