Structure of PDB 2dp6 Chain A Binding Site BS02

Receptor Information
>2dp6 Chain A (length=219) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MDREAFVQTLTACRLCPRLVAWREEVVGRKRAFRGEPYWARPVPGFGDPE
ARILLFGLAPGAHGSNRTGRPFTGDASGAFLYPLLHEAGLSSKPESLPGD
DLRLYGVYLTAAVRCAPPKNKPTPEELRACARWTEVELGLLPEVRVYVAL
GRIALEALLAHFGLRKSAHPFRHGAHYPLPGGRHLLASYHVSRQNTQTGR
LTREMFLEVLMEAKRLAGL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2dp6 Structure of Family 5 Uracil-DNA Glycosylase Bound to DNA Reveals Insights into the Mechanism for Substrate Recognition and Catalysis
Resolution1.8 Å
Binding residue
(original residue number in PDB)		K30 R31 A32 R193 Q197 T198
Binding residue
(residue number reindexed from 1)		K30 R31 A32 R193 Q197 T198
Enzymatic activity
Enzyme Commision number 3.2.2.-
Gene Ontology
Molecular Function
GO:0004844 uracil DNA N-glycosylase activity
GO:0016787 hydrolase activity
GO:0033958 DNA-deoxyinosine glycosylase activity
GO:0046872 metal ion binding
GO:0051536 iron-sulfur cluster binding
GO:0051539 4 iron, 4 sulfur cluster binding
GO:0097506 deaminated base DNA N-glycosylase activity
Biological Process
GO:0006281 DNA repair
GO:0006284 base-excision repair

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2dp6, PDBe:2dp6, PDBj:2dp6
PDBsum2dp6
PubMed
UniProtQ5SJ65|UDGB_THET8 Type-5 uracil-DNA glycosylase (Gene Name=udgb)

[Back to BioLiP]