Structure of PDB 2c6y Chain A Binding Site BS02

Receptor Information
>2c6y Chain A (length=98) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DSKPPYSYAQLIVQAITMAPDKQLTLNGIYTHITKNYPYYRTADKGWQNS
IRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPASESKLIEQAFRKRRPR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2c6y Crystal Structure of the Human Foxk1A-DNA Complex and its Implications on the Diverse Binding Specificity of Winged Helix/Forkhead Proteins.
Resolution2.4 Å
Binding residue
(original residue number in PDB)
L26 R52 H53 S56 L57 K63 K73 G74 W77 R98
Binding residue
(residue number reindexed from 1)
L26 R52 H53 S56 L57 K63 K73 G74 W77 R98
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:2c6y, PDBe:2c6y, PDBj:2c6y
PDBsum2c6y
PubMed16624804
UniProtQ01167|FOXK2_HUMAN Forkhead box protein K2 (Gene Name=FOXK2)

[Back to BioLiP]