Structure of PDB 2bzf Chain A Binding Site BS02

Receptor Information
>2bzf Chain A (length=88) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLV
LKKDEDLFREWLKDTCGANAKQSRDCFGCLREWCDAFL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2bzf Structural Basis for DNA Bridging by Barrier-to-Autointegration Factor.
Resolution2.87 Å
Binding residue
(original residue number in PDB)		Q5 K6 G25 G27 V29 L30
Binding residue
(residue number reindexed from 1)		Q4 K5 G24 G26 V28 L29
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003690 double-stranded DNA binding
GO:0005515 protein binding
GO:0042802 identical protein binding
GO:0042803 protein homodimerization activity
Biological Process
GO:0006325 chromatin organization
GO:0006979 response to oxidative stress
GO:0007084 mitotic nuclear membrane reassembly
GO:0009615 response to virus
GO:0010836 negative regulation of protein ADP-ribosylation
GO:0015074 DNA integration
GO:0032480 negative regulation of type I interferon production
GO:0045071 negative regulation of viral genome replication
GO:0045824 negative regulation of innate immune response
GO:0051276 chromosome organization
GO:0160049 negative regulation of cGAS/STING signaling pathway
Cellular Component
GO:0000785 chromatin
GO:0000793 condensed chromosome
GO:0005634 nucleus
GO:0005635 nuclear envelope
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2bzf, PDBe:2bzf, PDBj:2bzf
PDBsum2bzf
PubMed16155580
UniProtO75531|BAF_HUMAN Barrier-to-autointegration factor (Gene Name=BANF1)

[Back to BioLiP]