Structure of PDB 2bwl Chain A Binding Site BS02

Receptor Information
>2bwl Chain A (length=118) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DDSRYTKFLTQHHDAKPKGRDDRYCERMMKRRSLTSPCKDVNTFIHGNKS
NIKAICGANGSPYRENLRMSKSPFQVTTCKHTGGSPRPPCQYRASAGFRH
VVIACENGLPVHFDESFF
Ligand information
Ligand IDPO4
InChIInChI=1S/H3O4P/c1-5(2,3)4/h(H3,1,2,3,4)/p-3
InChIKeyNBIIXXVUZAFLBC-UHFFFAOYSA-K
SMILES
SoftwareSMILES
CACTVS 3.341[O-][P]([O-])([O-])=O
ACDLabs 10.04[O-]P([O-])([O-])=O
OpenEye OEToolkits 1.5.0[O-]P(=O)([O-])[O-]
FormulaO4 P
NamePHOSPHATE ION
ChEMBL
DrugBankDB14523
ZINC
PDB chain2bwl Chain A Residue 1121 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2bwl Structure of Murine Angiogenin: Features of the Substrate- and Cell-Binding Regions and Prospects for Inhibitor-Binding Studies.
Resolution1.62 Å
Binding residue
(original residue number in PDB)		Y6 K50
Binding residue
(residue number reindexed from 1)		Y5 K49
Annotation score3
Enzymatic activity
Catalytic site (original residue number in PDB) H13 K40 H113 F114 D115
Catalytic site (residue number reindexed from 1) H12 K39 H112 F113 D114
Enzyme Commision number 3.1.27.-
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003677 DNA binding
GO:0003723 RNA binding
GO:0003779 actin binding
GO:0004519 endonuclease activity
GO:0004540 RNA nuclease activity
GO:0004549 tRNA-specific ribonuclease activity
GO:0005102 signaling receptor binding
GO:0005507 copper ion binding
GO:0008201 heparin binding
GO:0042803 protein homodimerization activity
Biological Process
GO:0001525 angiogenesis
GO:0001666 response to hypoxia
GO:0001938 positive regulation of endothelial cell proliferation
GO:0007417 central nervous system development
GO:0009303 rRNA transcription
GO:0017148 negative regulation of translation
GO:0023052 signaling
GO:0030041 actin filament polymerization
GO:0030154 cell differentiation
GO:0032055 negative regulation of translation in response to stress
GO:0034063 stress granule assembly
GO:0036417 tRNA destabilization
GO:0043066 negative regulation of apoptotic process
GO:0048662 negative regulation of smooth muscle cell proliferation
GO:0050714 positive regulation of protein secretion
GO:0071425 hematopoietic stem cell proliferation
GO:0071470 cellular response to osmotic stress
GO:2000773 negative regulation of cellular senescence
Cellular Component
GO:0005576 extracellular region
GO:0005604 basement membrane
GO:0005615 extracellular space
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0030139 endocytic vesicle
GO:0030426 growth cone
GO:0031410 cytoplasmic vesicle
GO:0032311 angiogenin-PRI complex
GO:0043025 neuronal cell body

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2bwl, PDBe:2bwl, PDBj:2bwl
PDBsum2bwl
PubMed16301790
UniProtP21570|ANGI_MOUSE Angiogenin (Gene Name=Ang)

[Back to BioLiP]