Structure of PDB 2bqr Chain A Binding Site BS02

Receptor Information

>2bqr Chain A (length=341) Species: 273057 (Saccharolobus solfataricus P2)

MIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANYEA
RKFGVKAGIPIVEAKKILPNAVYLPMRKEVYQQVSSRIMNLLREYSEKIE
IASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNKVF
AKIAADMAKPNGIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGIN
KLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYNEPIRTRVRKSIGRIVT
MKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGR
TFPHGISKETAYSESVKLLQKILEEDERKIRRIGVRFSKFI

Ligand information

>2bqr Chain T (length=17)

catggaatccttccccc

Receptor-Ligand Complex Structure

Structure summary

• PDB: 2bqr DNA Adduct Bypass Polymerization by Sulfolobus Solfataricus DNA Polymerase Dpo4: Analysis and Crystal Structures of Multiple Base Pair Substitution and Frameshift Products with the Adduct 1,N2-Ethenoguanine.
• Resolution: 2.37 Å
• Binding residue (original residue number in PDB): V32 F37 S40 G41 A42 P60 G218 A220 R240 R242 K243 S244 I245 G246 R247 T250 K275 L293 R331 R332
• Binding residue (residue number reindexed from 1): V32 F37 S40 G41 A42 P60 G218 A220 R240 R242 K243 S244 I245 G246 R247 T250 K275 L293 R331 R332

Enzymatic activity

• Enzyme Commision number: 2.7.7.7: DNA-directed DNA polymerase.

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0003677 DNA binding
• GO:0003684 damaged DNA binding
• GO:0003887 DNA-directed DNA polymerase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006260 DNA replication
• GO:0006261 DNA-templated DNA replication
• GO:0006281 DNA repair
• GO:0006974 DNA damage response
• GO:0042276 error-prone translesion synthesis

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:2bqr, PDBe:2bqr, PDBj:2bqr
• PDBsum: 2bqr
• PubMed: 15965231
• UniProt: Q97W02|DPO4_SACS2 DNA polymerase IV (Gene Name=dbh)