Structure of PDB 2bam Chain A Binding Site BS02

Receptor Information
>2bam Chain A (length=207) Species: 1390 (Bacillus amyloliquefaciens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MEVEKEFITDEAKELLSKDKLIQQAYNEVKTSICSPIWPATSKTFTINNT
EKNCNGVVPIKELCYTLLEDTYNWYREKPLDILKLEKKKGGPIDVYKEFI
ENSELKRVGMEFETGNISSAHRSMNKLLLGLKHGEIDLAIILMPIKQLAY
YLTDRVTNFEELEPYFELTEGQPFIFIGFNAEAYNSNVPLIPKGSDGMSK
RSIKKWK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2bam The role of metals in catalysis by the restriction endonuclease BamHI.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		V57 K61 K89 G90 G91 D94 E111 T114 R122 K126 T153 D154 R155 K193 G194 D196 G197 M198
Binding residue
(residue number reindexed from 1)		V57 K61 K89 G90 G91 D94 E111 T114 R122 K126 T153 D154 R155 K193 G194 D196 G197 M198
Enzymatic activity
Enzyme Commision number 3.1.21.4: type II site-specific deoxyribonuclease.
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0003677 DNA binding
GO:0004519 endonuclease activity
GO:0009036 type II site-specific deoxyribonuclease activity
GO:0046872 metal ion binding
Biological Process
GO:0009307 DNA restriction-modification system

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2bam, PDBe:2bam, PDBj:2bam
PDBsum2bam
PubMed9783752
UniProtP23940|T2BA_BACAM Type II restriction enzyme BamHI (Gene Name=bamHIR)

[Back to BioLiP]