Structure of PDB 2az2 Chain A Binding Site BS02

Receptor Information
>2az2 Chain A (length=70) Species: 12287 (Flock House virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PSKLALIQELPDRIQTAVEAAMGMSYQDAPNNVRRDLDNLHACLNKAKLT
VSRMVTSLLEKPSVVAYLEG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2az2 Dual modes of RNA-silencing suppression by Flock House virus protein B2.
Resolution2.6 Å
Binding residue
(original residue number in PDB)
R36 D37 R54 M55 S58
Binding residue
(residue number reindexed from 1)
R35 D36 R53 M54 S57
Binding affinityPDBbind-CN: Kd=1.4nM
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2az2, PDBe:2az2, PDBj:2az2
PDBsum2az2
PubMed16228003
UniProtP68831|B2_FHV Protein B2 (Gene Name=B2)

[Back to BioLiP]