Structure of PDB 2aor Chain A Binding Site BS02

Receptor Information

>2aor Chain A (length=220) Species: 727 (Haemophilus influenzae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MIPQTLEQLLSQAQSIAGLTFGELADELHIPVPIDLKRDKGWVGMLLERA
LGATAGSKAEQDFSHLGVELKTLPINAEGYPLETTFVSLAPLVQNSGVKW
ENSHVRHKLSCVLWMPIEGSRHIPLRERHIGAPIFWKPTAEQERQLKQDW
EELMDLIVLGKLDQITARIGEVMQLRPKGANSRAVTKGIGKNGEIIDTLP
LGFYLRKEFTAQILNAFLET

Ligand information

>2aor Chain D (length=22) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

caggatccaagcttggatcctg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2aor MutH complexed with hemi- and unmethylated DNAs: coupling base recognition and DNA cleavage.
Resolution	2.0 Å
Binding residue (original residue number in PDB)	K45 K48 G49 G52 S65 K66 T80 P82 E91 F94 K186
Binding residue (residue number reindexed from 1)	K37 K40 G41 G44 S57 K58 T72 P74 E83 F86 K178
Binding affinity	PDBbind-CN: Kd=0.9uM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0004519	endonuclease activity

	Biological Process
GO:0006281	DNA repair
GO:0006298	mismatch repair
GO:0006304	DNA modification

	Cellular Component
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2aor, PDBe:2aor, PDBj:2aor
PDBsum	2aor
PubMed	16209953
UniProt	P44688\|MUTH_HAEIN DNA mismatch repair protein MutH (Gene Name=mutH)

[Back to BioLiP]