Structure of PDB 2an6 Chain A Binding Site BS02

Receptor Information

>2an6 Chain A (length=191) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

NSVLFPCKYASSGCEITLPHTEKAEHEELCEFRPYSCPCPGASCKWQGSL
DAVMPHLMHQHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGFHFML
VLEKQEKYDGHQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATPR
SIHEGIATAIMNSDCLVFDTSIAQLFAENGNLGINVTISMC

Ligand information

>2an6 Chain H (length=11) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

LRPVAMVRPTV

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2an6 Elucidation of the substrate binding site of Siah ubiquitin ligase
Resolution	3.0 Å
Binding residue (original residue number in PDB)	H111 T112
Binding residue (residue number reindexed from 1)	H20 T21

Enzymatic activity

Enzyme Commision number

2.3.2.27: RING-type E3 ubiquitin transferase.

Gene Ontology

	Molecular Function
GO:0008270	zinc ion binding

	Biological Process
GO:0006511	ubiquitin-dependent protein catabolic process
GO:0007275	multicellular organism development

	Cellular Component
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2an6, PDBe:2an6, PDBj:2an6
PDBsum	2an6
PubMed	16615911
UniProt	P61092\|SIA1A_MOUSE E3 ubiquitin-protein ligase SIAH1A (Gene Name=Siah1a)

[Back to BioLiP]