Structure of PDB 2adc Chain A Binding Site BS02

Receptor Information

>2adc Chain A (length=208) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GRIAIPGLAGAGNSVLLVSNLNPERVTPQSLFILFGVYGDVQRVKILFNK
KENALVQMADGNQAQLAMSHLNGHKLHGKPIRITLSKHQNVQLPREGQED
QGLTKDYGNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVSEEDLKVL
FSSNGGVVKGFKFFQKDRKMALIQMGSVEEAVQALIDLHNHDLGENHHLR
VSFSKSTI

Ligand information

>2adc Chain C (length=6) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

cucucu

......

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2adc Structure of PTB bound to RNA: specific binding and implications for splicing regulation
Resolution	N/A
Binding residue (original residue number in PDB)	L340 K368 L370 F371 N376 L378 R405 S409 K410 H411 N413 Q415 P417 R418 E422 L426
Binding residue (residue number reindexed from 1)	L17 K45 L47 F48 N53 L55 R82 S86 K87 H88 N90 Q92 P94 R95 E99 L103

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003676	nucleic acid binding
GO:0003723	RNA binding

	Biological Process
GO:0006397	mRNA processing

	Cellular Component
GO:0005634	nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2adc, PDBe:2adc, PDBj:2adc
PDBsum	2adc
PubMed	16179478
UniProt	P26599\|PTBP1_HUMAN Polypyrimidine tract-binding protein 1 (Gene Name=PTBP1)

[Back to BioLiP]