Structure of PDB 2a66 Chain A Binding Site BS02

Receptor Information

>2a66 Chain A (length=95) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKRYTCIENQNCQIDKT
QRKRCPYCRFQKCLSVGMKLEAVRADRMRGGRNKFGPMYKRDRAL

Ligand information

>2a66 Chain C (length=12) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ctggccttgaac

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2a66 Crystal Structure of the Human LRH-1 DBD-DNA Complex Reveals Ftz-F1 Domain Positioning is Required for Receptor Activity.
Resolution	2.2 Å
Binding residue (original residue number in PDB)	E104 S105 R112 R135 K136 R142 R162 G163 G164
Binding residue (residue number reindexed from 1)	E21 S22 R29 R52 K53 R59 R79 G80 G81
Binding affinity	PDBbind-CN: Kd=122nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity
GO:0004879	nuclear receptor activity
GO:0008270	zinc ion binding
GO:0043565	sequence-specific DNA binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:2a66, PDBe:2a66, PDBj:2a66
PDBsum	2a66
PubMed	16289203
UniProt	O00482\|NR5A2_HUMAN Nuclear receptor subfamily 5 group A member 2 (Gene Name=NR5A2)

[Back to BioLiP]