Structure of PDB 1zns Chain A Binding Site BS02

Receptor Information
>1zns Chain A (length=118) Species: 316407 (Escherichia coli str. K-12 substr. W3110) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PGKATGKGKPVNNKWLNNAGKDLGSPVPDRIANKLRDKEFKSFDDFRKKF
WEEVSKDPELSKQFSRNNNDRMKVGKAPKTRTQDVSGKRTSFELHEEKVY
DMDNISVVTPKRHIDIHR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1zns Crystal structural analysis and metal-dependent stability and activity studies of the ColE7 endonuclease domain in complex with DNA/Zn2+ or inhibitor/Ni2+
Resolution2.5 Å
Binding residue
(original residue number in PDB)		K490 K498 G536 K537 R538 R574
Binding residue
(residue number reindexed from 1)		K41 K49 G87 K88 R89 R118
Enzymatic activity
Catalytic site (original residue number in PDB) R538 H544 E545 H569 H573
Catalytic site (residue number reindexed from 1) R89 H95 E96 H113 H117
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
GO:0005102 signaling receptor binding
Biological Process
GO:0009617 response to bacterium
GO:0019835 cytolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1zns, PDBe:1zns, PDBj:1zns
PDBsum1zns
PubMed16434744
UniProtQ47112|CEA7_ECOLX Colicin-E7 (Gene Name=colE7)

[Back to BioLiP]