Structure of PDB 1zlk Chain A Binding Site BS02

Receptor Information
>1zlk Chain A (length=65) Species: 1773 (Mycobacterium tuberculosis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DPLSGLTDQERTLLGLLSEGLTNKQIADRMFLAEKTVKNYVSRLLAKLGM
ERRTQAAVFATELKR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1zlk Structures of Mycobacterium tuberculosis DosR and DosR-DNA complex involved in gene activation during adaptation to hypoxic latency.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		Q153 L176 K179 T180 Y184
Binding residue
(residue number reindexed from 1)		Q9 L32 K35 T36 Y40
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1zlk, PDBe:1zlk, PDBj:1zlk
PDBsum1zlk
PubMed16246368
UniProtP9WMF9|DEVR_MYCTU DNA-binding transcriptional activator DevR/DosR (Gene Name=devR)

[Back to BioLiP]