Structure of PDB 1zkf Chain A Binding Site BS02

Receptor Information

>1zkf Chain A (length=165) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKG
SCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSM
ANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNG
KTSKKITIADCGQLE

Ligand information

>1zkf Chain D (length=6) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

cAGPFc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1zkf Mechanistic Insights of Cyclophilin-A from X-Ray Cyrstallographic and Nuclear Magnet Resonance Investigations
Resolution	2.55 Å
Binding residue (original residue number in PDB)	W121 K125
Binding residue (residue number reindexed from 1)	W121 K125

Enzymatic activity

Catalytic site (original residue number in PDB)	R55 F60 Q63 N102 F113 L122 H126
Catalytic site (residue number reindexed from 1)	R55 F60 Q63 N102 F113 L122 H126
Enzyme Commision number	5.2.1.8: peptidylprolyl isomerase.

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003755	peptidyl-prolyl cis-trans isomerase activity
GO:0005178	integrin binding
GO:0005515	protein binding
GO:0016018	cyclosporin A binding
GO:0046790	virion binding
GO:0051082	unfolded protein binding
GO:1904399	heparan sulfate binding

	Biological Process
GO:0000413	protein peptidyl-prolyl isomerization
GO:0001933	negative regulation of protein phosphorylation
GO:0001934	positive regulation of protein phosphorylation
GO:0006457	protein folding
GO:0006469	negative regulation of protein kinase activity
GO:0006915	apoptotic process
GO:0019076	viral release from host cell
GO:0030168	platelet activation
GO:0030182	neuron differentiation
GO:0030593	neutrophil chemotaxis
GO:0030595	leukocyte chemotaxis
GO:0032148	activation of protein kinase B activity
GO:0032873	negative regulation of stress-activated MAPK cascade
GO:0034389	lipid droplet organization
GO:0034599	cellular response to oxidative stress
GO:0042118	endothelial cell activation
GO:0043410	positive regulation of MAPK cascade
GO:0045069	regulation of viral genome replication
GO:0045070	positive regulation of viral genome replication
GO:0050714	positive regulation of protein secretion
GO:0051092	positive regulation of NF-kappaB transcription factor activity
GO:0060352	cell adhesion molecule production
GO:0061944	negative regulation of protein K48-linked ubiquitination
GO:0070527	platelet aggregation
GO:1902176	negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway
GO:1903901	negative regulation of viral life cycle
GO:2001233	regulation of apoptotic signaling pathway

	Cellular Component
GO:0005576	extracellular region
GO:0005615	extracellular space
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005925	focal adhesion
GO:0016020	membrane
GO:0031982	vesicle
GO:0032991	protein-containing complex
GO:0034774	secretory granule lumen
GO:0070062	extracellular exosome
GO:1904813	ficolin-1-rich granule lumen

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1zkf, PDBe:1zkf, PDBj:1zkf
PDBsum	1zkf
PubMed
UniProt	P62937\|PPIA_HUMAN Peptidyl-prolyl cis-trans isomerase A (Gene Name=PPIA)

[Back to BioLiP]