Structure of PDB 1zh5 Chain A Binding Site BS02

Receptor Information
>1zh5 Chain A (length=185) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GDNEKMAALEAKICHQIEYYFGDFNLPRDKFLKEQIKLDEGWVPLEIMIK
FNRLNRLTTDFNVIVEALSKSKAELMEISEDKTKIRRSPSKPLPEVTDEY
KNDVKNRSVYIKGFPTDATLDDIKEWLEDKGQVLNIQMRRTLHKAFKGSI
FVVFDSIESAKKFVETPGQKYKETDLLILFKDDYF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1zh5 Structural Basis for Recognition and Sequestration of UUU(OH) 3' Temini of Nascent RNA Polymerase III Transcripts by La, a Rheumatic Disease Autoantigen.
Resolution1.85 Å
Binding residue
(original residue number in PDB)		Y23 Y24 D33 F55 N56 R57 I140
Binding residue
(residue number reindexed from 1)		Y19 Y20 D29 F51 N52 R53 I136
Binding affinityPDBbind-CN: Kd=7nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
Biological Process
GO:0006396 RNA processing
Cellular Component
GO:0005634 nucleus
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1zh5, PDBe:1zh5, PDBj:1zh5
PDBsum1zh5
PubMed16387655
UniProtP05455|LA_HUMAN Lupus La protein (Gene Name=SSB)

[Back to BioLiP]