Structure of PDB 1z9o Chain A Binding Site BS02

Receptor Information
>1z9o Chain A (length=119) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EQILVLDPPSDLKFKGPFTDVVTTNLKLQNPSDRKVCFKVKTTAPRRYCV
RPNSGVIDPGSIVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPSDMEAVW
KEAKPDELMDSKLRCVFEM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1z9o Structural basis of FFAT motif-mediated ER targeting
Resolution1.9 Å
Binding residue
(original residue number in PDB)		R50 E103
Binding residue
(residue number reindexed from 1)		R46 E97
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0005789 endoplasmic reticulum membrane

View graph for
Cellular Component
External links
PDB RCSB:1z9o, PDBe:1z9o, PDBj:1z9o
PDBsum1z9o
PubMed16004875
UniProtQ9Z270|VAPA_RAT Vesicle-associated membrane protein-associated protein A (Gene Name=Vapa)

[Back to BioLiP]