Structure of PDB 1z9c Chain A Binding Site BS02

Receptor Information
>1z9c Chain A (length=137) Species: 1423 (Bacillus subtilis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KLENQLSFLLYASSREMTKQYKPLLDKLNITYPQYLALLLLWEHETLTVK
KMGEQLYLDSGTLTPMLKRMEQQGLITRKRSEEDERSVLISLTEDGALLK
EKAVDIPGTILGLSKQSGEDLKQLKSALYTLLETLHQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1z9c Structure of an OhrR-ohrA Operator Complex Reveals the DNA Binding Mechanism of the MarR Family.
Resolution2.64 Å
Binding residue
(original residue number in PDB)		T39 P41 G69 T70 R77 E93 R94
Binding residue
(residue number reindexed from 1)		T31 P33 G61 T62 R69 E85 R86
Binding affinityPDBbind-CN: Kd=2.5nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000977 RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0001227 DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0042802 identical protein binding
GO:0042803 protein homodimerization activity
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0006355 regulation of DNA-templated transcription
GO:0006950 response to stress
GO:0042542 response to hydrogen peroxide
GO:0045892 negative regulation of DNA-templated transcription
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1z9c, PDBe:1z9c, PDBj:1z9c
PDBsum1z9c
PubMed16209951
UniProtO34777|OHRR_BACSU Organic hydroperoxide resistance transcriptional regulator (Gene Name=ohrR)

[Back to BioLiP]