Structure of PDB 1yz9 Chain A Binding Site BS02

Receptor Information
>1yz9 Chain A (length=220) Species: 63363 (Aquifex aeolicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKMLEQLEKKLGYTFKDKSLLEKALTHVSYSKKEHYETLEFLGDALVNFF
IVDLLVQYSPNKREGFLSPLKAYLISEEFFNLLAQKLELHKFIRIKRGKI
NETIIGDVFQALWAAVYIDSGRDANFTRELFYKLFKEDILSAIKEGRVKK
DYKTILQEITQKRWKERPEYRLISVEGPHHKKKFIVEAKIKEYRTLGEGK
SKKEAEQRAAEELIKLLEES
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1yz9 Intermediate states of ribonuclease III in complex with double-stranded RNA
Resolution2.1 Å
Binding residue
(original residue number in PDB)		E145 R147 K150 E158 Q161 R167
Binding residue
(residue number reindexed from 1)		E145 R147 K150 E158 Q161 R167
Enzymatic activity
Enzyme Commision number 3.1.26.3: ribonuclease III.
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003725 double-stranded RNA binding
GO:0004519 endonuclease activity
GO:0004525 ribonuclease III activity
GO:0042802 identical protein binding
GO:0046872 metal ion binding
Biological Process
GO:0006364 rRNA processing
GO:0006396 RNA processing
GO:0006397 mRNA processing
GO:0008033 tRNA processing
GO:0010468 regulation of gene expression
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1yz9, PDBe:1yz9, PDBj:1yz9
PDBsum1yz9
PubMed16216575
UniProtO67082|RNC_AQUAE Ribonuclease 3 (Gene Name=rnc)

[Back to BioLiP]