Structure of PDB 1wvl Chain A Binding Site BS02

Receptor Information
>1wvl Chain A (length=80) Species: 2285 (Sulfolobus acidocaldarius) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MVKVKFKYKGEEKEVDTSKIKKVWRVGKMVSFTYDDNGKTGRGAVSEKDA
PKELLDMLARAEREKKGVLKKLRAVENELH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1wvl Design and characterization of a multimeric DNA binding protein using Sac7d and GCN4 as templates
Resolution2.6 Å
Binding residue
(original residue number in PDB)		Y8 K9 K28 M29 A44 S46
Binding residue
(residue number reindexed from 1)		Y8 K9 K28 M29 A44 S46
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004521 RNA endonuclease activity
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:1wvl, PDBe:1wvl, PDBj:1wvl
PDBsum1wvl
PubMed16028219
UniProtP13123|DN7D_SULAC DNA-binding protein 7d (Gene Name=Saci_0064)

[Back to BioLiP]