Structure of PDB 1wtw Chain A Binding Site BS02

Receptor Information
>1wtw Chain A (length=66) Species: 2285 (Sulfolobus acidocaldarius) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MVKVKFKYKGEEKEVDTSKIKKVWRAGKMVSFTYDDNGKTGRGAVSEKDA
PKELLDMLARAEREKK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1wtw Probing the DNA kink structure induced by the hyperthermophilic chromosomal protein Sac7d
Resolution2.2 Å
Binding residue
(original residue number in PDB)		Y8 K9 A26 M29 S46
Binding residue
(residue number reindexed from 1)		Y8 K9 A26 M29 S46
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004521 RNA endonuclease activity
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:1wtw, PDBe:1wtw, PDBj:1wtw
PDBsum1wtw
PubMed15653643
UniProtP13123|DN7D_SULAC DNA-binding protein 7d (Gene Name=Saci_0064)

[Back to BioLiP]