Structure of PDB 1wto Chain A Binding Site BS02

Receptor Information
>1wto Chain A (length=65) Species: 2285 (Sulfolobus acidocaldarius) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VKVKFKYKGEEKEVDTSKIKKVWRFGKFVSFTYDDNGKTGRGAVSEKDAP
KELLDMLARAEREKK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1wto Probing the DNA kink structure induced by the hyperthermophilic chromosomal protein Sac7d
Resolution1.5 Å
Binding residue
(original residue number in PDB)		Y8 F26 F29 R42
Binding residue
(residue number reindexed from 1)		Y7 F25 F28 R41
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004521 RNA endonuclease activity
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:1wto, PDBe:1wto, PDBj:1wto
PDBsum1wto
PubMed15653643
UniProtP13123|DN7D_SULAC DNA-binding protein 7d (Gene Name=Saci_0064)

[Back to BioLiP]