Structure of PDB 1wd1 Chain A Binding Site BS02

Receptor Information
>1wd1 Chain A (length=64) Species: 2285 (Sulfolobus acidocaldarius) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VKVKFKYKGEEKEVDTSKIKKVWRVGKMVSFTYDDNGKTGRGAVSEKDAP
KELLDMLARAEREK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1wd1 Structures of the hyperthermophilic chromosomal protein Sac7d in complex with DNA decamers.
Resolution2.2 Å
Binding residue
(original residue number in PDB)		Y8 K9 K28 M29 S46
Binding residue
(residue number reindexed from 1)		Y7 K8 K27 M28 S45
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004521 RNA endonuclease activity
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:1wd1, PDBe:1wd1, PDBj:1wd1
PDBsum1wd1
PubMed15272160
UniProtP13123|DN7D_SULAC DNA-binding protein 7d (Gene Name=Saci_0064)

[Back to BioLiP]