Structure of PDB 1ums Chain A Binding Site BS02

Receptor Information

>1ums Chain A (length=166) Species: 9606 (Homo sapiens)

FRTFPGIPKWRKTHLTYRIVNYTPDLPKDAVDSAVEKALKVWEEVTPLTF
SRLYEGEADIMISFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDD
DEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANTEALMYPLYHSLTDLTRF
RLSQDDINGIQSLYGP

Ligand information

• Ligand ID: ZN
• InChI: InChI=1S/Zn/q+2
• InChIKey: PTFCDOFLOPIGGS-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [Zn++]
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Zn+2]
• Formula: Zn
• Name: ZINC ION
• ChEMBL: CHEMBL1236970
• DrugBank: DB14532
• PDB chain: 1ums Chain A Residue 2

Receptor-Ligand Complex Structure

Structure summary

• PDB: 1ums Solution structure of the catalytic domain of human stromelysin complexed with a hydrophobic inhibitor.
• Resolution: N/A
• Binding residue (original residue number in PDB): H151 D153 H166 H179
• Binding residue (residue number reindexed from 1): H69 D71 H84 H97
• Annotation score: 4

Enzymatic activity

• Catalytic site (original residue number in PDB): H201 E202 H205 H211
• Catalytic site (residue number reindexed from 1): H119 E120 H123 H129
• Enzyme Commision number: 3.4.24.17: stromelysin 1.

Gene Ontology

Molecular Function

• GO:0004222 metalloendopeptidase activity
• GO:0008237 metallopeptidase activity
• GO:0008270 zinc ion binding

Biological Process

• GO:0006508 proteolysis

Cellular Component

• GO:0031012 extracellular matrix

External links

• PDB: RCSB:1ums, PDBe:1ums, PDBj:1ums
• PDBsum: 1ums
• PubMed: 8580839
• UniProt: P08254|MMP3_HUMAN Stromelysin-1 (Gene Name=MMP3)