Structure of PDB 1u78 Chain A Binding Site BS02

Receptor Information
>1u78 Chain A (length=103) Species: 6239 (Caenorhabditis elegans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PRGSALSDTERAQLDVMKLLNVSLHEMSRKISRSRHCIRVYLKDPVSYGT
SKRAPRRKALSVRDERNVIRAASNSCKTARDIRNELQLSASKRTILNVIK
RSG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1u78 Structural analysis of the bipartite DNA-binding domain of Tc3 transposase bound to transposon DNA
Resolution2.69 Å
Binding residue
(original residue number in PDB)		P2 R3 G4 S5 R34 S35 H37 C38 Y49 S52 R54 A55 R57 R58 T79 A80 R81 K93 R94 L97
Binding residue
(residue number reindexed from 1)		P1 R2 G3 S4 R33 S34 H36 C37 Y48 S51 R53 A54 R56 R57 T78 A79 R80 K92 R93 L96
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:1u78, PDBe:1u78, PDBj:1u78
PDBsum1u78
PubMed15304566
UniProtP34257|TC3A_CAEEL Transposable element Tc3 transposase (Gene Name=tc3a)

[Back to BioLiP]