Structure of PDB 1u63 Chain A Binding Site BS02

Receptor Information
>1u63 Chain A (length=214) Species: 2190 (Methanocaldococcus jannaschii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MDREALLQAVKEARELAKPRNFTQSFEFIATLKEIDMRKPENRIKTEVVL
PHGRGKEAKIAVIGTGDLAKQAEELGLTVIRKEEIEELGKNKRKLRKIAK
AHDFFIAQADLMPLIGRYMGVILGPRGKMPKPVPANANIKPLVERLKKTV
VINTRDKPYFQVLVGNEKMTDEQIVDNIEAVLNVVAKKYEKGLYHIKDAY
VKLTMGPAVKVKKE
Ligand information
>1u63 Chain D (length=49) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gggagugaaggaggcucgcgaacucgcgaagccgagaaacuucacuccc
.<<<<<<<<<..<<<<<<<<....>>>>.>>>>......>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1u63 Ribosomal protein L1 recognizes the same specific structural motif in its target sites on the autoregulatory mRNA and 23S rRNA.
Resolution3.4 Å
Binding residue
(original residue number in PDB)		K90 K92 R93 K94
Binding residue
(residue number reindexed from 1)		K90 K92 R93 K94
Binding affinityPDBbind-CN: Kd=0.52nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
GO:0006417 regulation of translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1u63, PDBe:1u63, PDBj:1u63
PDBsum1u63
PubMed15659579
UniProtP54050|RL1_METJA Large ribosomal subunit protein uL1 (Gene Name=rpl1)

[Back to BioLiP]