Structure of PDB 1tp8 Chain A Binding Site BS02

Receptor Information
>1tp8 Chain A (length=133) Species: 291940 (Artocarpus hirsutus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GKAFDDGAFTGIREINLSYNKETAIGDFQVVYDLNGSPYVGQNHSSFISG
FTPVKISLDFPSEYITEVSGYTGNVSGYVVVRSLTFKTNKKTYGPYGVTS
GTPFNLPIENGLIVGFKGSIGYWMDYFSMYLSL
Ligand information
>1tp8 Chain D (length=16) Species: 3490 (Artocarpus integer) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SGKSQTVIVGPWGAKV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1tp8 Two orthorhombic crystal structures of a galactose-specific lectin from Artocarpus hirsuta in complex with methyl-alpha-D-galactose.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		N105 P107 E109 N110 L133
Binding residue
(residue number reindexed from 1)		N105 P107 E109 N110 L133
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0019862 IgA binding
GO:0030246 carbohydrate binding
Biological Process
GO:0008150 biological_process
Cellular Component
GO:0005575 cellular_component

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1tp8, PDBe:1tp8, PDBj:1tp8
PDBsum1tp8
PubMed15272163
UniProtP18670|LECA_ARTIN Agglutinin alpha chain

[Back to BioLiP]