Structure of PDB 1tf6 Chain A Binding Site BS02

Receptor Information
>1tf6 Chain A (length=179) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YKRYICSFADCGAAYNKNWKLQAHLCKHTGEKPFPCKEEGCEKGFTSLHH
LTRHSLTHTGEKNFTCDSDGCDLRFTTKANMKKHFNRFHNIKICVYVCHF
ENCGKAFKKHNQLKVHQFSHTQQLPYECPHEGCDKRFSLPSRLKRHEKVH
AGYPCKKDDSCSFVGKTWTLYLKHVAECH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1tf6 Differing roles for zinc fingers in DNA recognition: structure of a six-finger transcription factor IIIA complex.
Resolution3.1 Å
Binding residue
(original residue number in PDB)
R12 Y13 K26 W28 H58 K87 K92 P149 S150
Binding residue
(residue number reindexed from 1)
R3 Y4 K17 W19 H49 K78 K83 P140 S141
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1tf6, PDBe:1tf6, PDBj:1tf6
PDBsum1tf6
PubMed9501194
UniProtP03001|TF3A_XENLA Transcription factor IIIA (Gene Name=gtf3a)

[Back to BioLiP]