Structure of PDB 1tf3 Chain A Binding Site BS02

Receptor Information
>1tf3 Chain A (length=92) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKRYICSFADCGAAYNKNWKLQAHLSKHTGEKPFPCKEEGCEKGFTSLHH
LTRHSLTHTGEKNFTCDSDGCDLRFTTKANMKKHFNRFHNIK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1tf3 Domain packing and dynamics in the DNA complex of the N-terminal zinc fingers of TFIIIA.
ResolutionN/A
Binding residue
(original residue number in PDB)
M1 K11 Y13 N25 K26 N27 W28 H58 K87 K91
Binding residue
(residue number reindexed from 1)
M1 K2 Y4 N16 K17 N18 W19 H49 K78 K82
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1tf3, PDBe:1tf3, PDBj:1tf3
PDBsum1tf3
PubMed9253405
UniProtP03001|TF3A_XENLA Transcription factor IIIA (Gene Name=gtf3a)

[Back to BioLiP]