Structure of PDB 1t9j Chain A Binding Site BS02

Receptor Information
>1t9j Chain A (length=151) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TKYNKEFLLYLAGFVDGDGSIIAQIKPNQSYKFKHQLSLTFQVTEKTQRR
WFLDKLVDEIGVGYVRDRGSVSDYILSEIKPLHNFLTQLQPFLKLKQKQA
NLVLKIIEQLPSAKESPDKFLEVCTWVDQIAALNDSKTRKTTSETVRAVL
D
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1t9j Metal-Dependent DNA Cleavage Mechanism of the I-CreI LAGLIDADG Homing Endonuclease.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		S32 Y33 K34 Q38 Y66 R68 R70 E80 I81 K116 D137 K139
Binding residue
(residue number reindexed from 1)		S30 Y31 K32 Q36 Y64 R66 R68 E78 I79 K114 D135 K137
Binding affinityPDBbind-CN: Kd=0.6nM
Enzymatic activity
Catalytic site (original residue number in PDB) G19 D20
Catalytic site (residue number reindexed from 1) G17 D18
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
GO:0042802 identical protein binding
GO:0046872 metal ion binding
Biological Process
GO:0006314 intron homing
Cellular Component
GO:0009507 chloroplast

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1t9j, PDBe:1t9j, PDBj:1t9j
PDBsum1t9j
PubMed15518550
UniProtP05725|DNE1_CHLRE DNA endonuclease I-CreI

[Back to BioLiP]