Structure of PDB 1t38 Chain A Binding Site BS02

Receptor Information
>1t38 Chain A (length=151) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EMKRTTLDSPLGKLELSGCEQGLHEIKLLGPEPLMQCTAWLNAYFHQPEA
IEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPK
AARAVGGAMRGNPVPILIPSHRVVCSSGAVGNYSGGLAVKEWLLAHEGHR
L
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1t38 DNA binding and nucleotide flipping by the human DNA repair protein AGT.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		F94 T95 N123 K125 A126 R128 A129
Binding residue
(residue number reindexed from 1)		F69 T70 N98 K100 A101 R103 A104
Enzymatic activity
Enzyme Commision number 2.1.1.63: methylated-DNA--[protein]-cysteine S-methyltransferase.
Gene Ontology
Molecular Function
GO:0003824 catalytic activity
GO:0003908 methylated-DNA-[protein]-cysteine S-methyltransferase activity
Biological Process
GO:0006281 DNA repair

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1t38, PDBe:1t38, PDBj:1t38
PDBsum1t38
PubMed15221026
UniProtP16455|MGMT_HUMAN Methylated-DNA--protein-cysteine methyltransferase (Gene Name=MGMT)

[Back to BioLiP]