Structure of PDB 1t2t Chain A Binding Site BS02

Receptor Information
>1t2t Chain A (length=96) Species: 10665 (Tequatrovirus T4) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KFCKCGVRIQTSAYTCSKCRNRSGENNSFFNHKHSDITKSKISEKMKGKK
PSNIKKISCDGVIFDCAADAARHFKISSGLVTYRVKSDKWNWFYIN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1t2t Intron-encoded homing endonuclease I-TevI also functions as a transcriptional autorepressor.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		Q158 A161 Y162 T163 C164 S165 R168 S176 F177 H182 T186 I190 K193 M194 K197 S200 N201 S225 L228 Y231 K237
Binding residue
(residue number reindexed from 1)		Q10 A13 Y14 T15 C16 S17 R20 S28 F29 H34 T38 I42 K45 M46 K49 S52 N53 S77 L80 Y83 K89
Binding affinityPDBbind-CN: Kd=5.3nM
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004519 endonuclease activity

View graph for
Molecular Function
External links
PDB RCSB:1t2t, PDBe:1t2t, PDBj:1t2t
PDBsum1t2t
PubMed15361856
UniProtP13299|TEV1_BPT4 Intron-associated endonuclease 1 (Gene Name=ITEVIR)

[Back to BioLiP]