Structure of PDB 1sx8 Chain A Binding Site BS02

Receptor Information

>1sx8 Chain A (length=241) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SLRSDLINALYDENQKYDVCGIISAEGKIYPLGSDTKVLSTIFELFSRPI
INKIAEKHGYIVEEPKQQNHYPDFTLYKPSEPNKKIAIDIATTYTNKENE
KIKFTLGGYTSFIRNNTKNIVYPFDQYIAHWIIGYVYTRVKSSLKTYNIN
ELNEIPKPYKGVKVFLQDKWVIAGDLAGSGNTTNIGSIHAHYKDFVEGKG
IFDSEDEFLDYWRNYERTSQLRNDKYNNISEYRNWIYRGRK

Ligand information

>1sx8 Chain D (length=10) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

caagatatct

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1sx8 DNA Cleavage by EcoRV Endonuclease: Two Metal Ions in Three Metal Ion Binding Sites
Resolution	2.15 Å
Binding residue (original residue number in PDB)	K38 Q69 N70 L180 S183 G184 N185 S223
Binding residue (residue number reindexed from 1)	K37 Q68 N69 L176 S179 G180 N181 S219

Enzymatic activity

Enzyme Commision number

3.1.21.4: type II site-specific deoxyribonuclease.

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0004519	endonuclease activity
GO:0009036	type II site-specific deoxyribonuclease activity
GO:0046872	metal ion binding

	Biological Process
GO:0009307	DNA restriction-modification system

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:1sx8, PDBe:1sx8, PDBj:1sx8
PDBsum	1sx8
PubMed	15170321
UniProt	P04390\|T2E5_ECOLX Type II restriction enzyme EcoRV (Gene Name=ecoRVR)

[Back to BioLiP]